DPCstruct | MC5084
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 112 ± 10 aa |
| Standard deviation of domain lengths | 9.91 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 18.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A521A1F5 | 5-110 | FYGCDEELQNEQVNEITVYYTFSVTQAQAQQLGAYLSLGKNAEPCVLYLDKNEHGFIIKRVVKTEKDTSNYSSYPRKLSRDLFKKQP… |
| A0A1I0PFV6 | 477-580 | YGNEINYHGLQLFYKDGVTLEDATKLEEFLISSAFANGSTQSVQILKHDSTYIFRYVIDESKMTTEVRTIIPAFASSISENVFNGAQ… |
| A0A0Q5US90 | 19-122 | None |
| A0A259TVD3 | 164-266 | None |
| A0A517XN67 | 14-135 | None |
| A0A517XW38 | 212-337 | None |
| A0A3B9N727 | 131-244 | None |
| A0A2G2EWA9 | 9-123 | None |
| A0A218P5H9 | 13-132 | None |
| A0A090Q847 | 3-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.