DPCstruct | MC5083
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 75 ± 8 aa |
| Standard deviation of domain lengths | 7.86 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 91.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 28.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A506U5M2 | 79-147 | APAAKHASVMPSDTTVLTGVVALHIGMGGAVVVEMDGVTASYLVQGNTVLPVKAQKVLATGTTAAEIVA |
| A0A3S0BQL4 | 27-98 | IVDSGTVTFDVDYGEYARWIYVGTTGNISYVKYDGTTQTLPNIAAGIWHPICSVRINSSGTSIAANQIFWGS |
| H6CE09 | 1-59 | None |
| A0A1G9RIP5 | 1-73 | None |
| A0A318TXY6 | 466-544 | None |
| A0A2E6HBZ2 | 74-151 | None |
| A0A4R6FLG3 | 31-110 | None |
| A0A4V1QZN3 | 85-161 | None |
| A0A1I6M5B5 | 42-110 | None |
| A0A839YCJ6 | 12-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.