DPCstruct | MC50821
Metacluster Properties and Pfam Annotations
| Number of structural domains | 95 |
|---|---|
| Mean domain length (aa) | 119 ± 22 aa |
| Standard deviation of domain lengths | 22.06 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 88.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 24.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0529 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S8H7H8 | 44-156 | DPLPGLDRGRTDILFLASLAPSSHNIQPWFVRIRDADHWVVGADVNRRLSAVDPQNRELMLSIGAFTENIVLAASASGYEAEIEVLA… |
| A0A7I7LHQ2 | 8-118 | EETVIRESVALASRAPSLHNSQPWRWVAEADTLQLWADRARSMPATDHAGRELILSCGAVLDHLRVAMSAAGWDSVTERMPDRGNPD… |
| A0A381KNE6 | 1-95 | None |
| A0A5Q4F7Q6 | 2-122 | None |
| F3NJY9 | 385-530 | None |
| R7WR52 | 3-131 | None |
| A0A6N9Y5P4 | 8-136 | None |
| A0A6I5VK70 | 1-136 | None |
| A0A1I0HUP6 | 193-297 | None |
| A0A7W3ZFI3 | 10-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.