DPCstruct | MC5082
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 158 ± 18 aa |
| Standard deviation of domain lengths | 18.38 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 73.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 44.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D6HIL5 | 1-136 | MDLNDKIPDTSSADARKGRDIQGIPWEQINITRKKYRQSRLEQYKNYENVPNSGEEAMKDCKPTEKGGIYYEFRRNTRSVKSTILHF… |
| A0A7J9JW97 | 1-169 | MAEEYDMEDIDDMDEEFCGRDMSGSESDVDEYDYSNNKISDTSAAEARRGKDIQGIPWDQLSITREKYRQTRLEQYKNYENIPHSGE… |
| A0A453RWD8 | 108-244 | None |
| A0A453RW14 | 1-181 | None |
| A0A453RWE2 | 1-179 | None |
| A0A453RI65 | 11-170 | None |
| A0A804LL55 | 21-182 | None |
| A0A1X2HLP1 | 5-151 | None |
| A0A804NVF2 | 34-187 | None |
| A0A453B1N0 | 18-230 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.