DPCstruct | MC50812
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 170 ± 20 aa |
| Standard deviation of domain lengths | 19.61 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 29.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N6ZKW3 | 19-173 | DQRKREKQAALIEASLRSGKYALFLQEVPKIKTSHCRAWDCMPRRSTGNPIIRSYYRFALKRISARSIEYYHITCLERLLPDLPNFV… |
| A0A094AYV5 | 22-205 | TRVVRDRHYYLRIEEEFGAEEERRSRLTQEERMAEDGRKLQRRLEQDAAMTILLQPSPPIHMRRAHCRASECIIANASPRGDSLIVA… |
| A0A1L7WHW1 | 47-219 | None |
| A0A093XUI6 | 86-282 | None |
| A0A094IV15 | 297-501 | None |
| W7E4K4 | 1-186 | None |
| A0A370TTD8 | 111-275 | None |
| A6QSM2 | 17-174 | None |
| A0A5N7CUB6 | 15-149 | None |
| A0A094DQM7 | 1-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.