DPCstruct | MC5081
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 82 ± 8 aa |
| Standard deviation of domain lengths | 8.06 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 52.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0173 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G9HYN8 | 1-81 | MIPIFCDVKPSQLRVVDDGSMTAEEVERFSIALEEAKYTVGLAFDSQKGNWSDVVKNAADIVIESLIEVEKDEERKLQQNN |
| A0A7J9JVW8 | 7-87 | VIPIFCDIKPSELRIVNNDNVPLKDLERFNLALEEAKYTVGLTFNSSKGNLSDVVKNASEIVIESLIEMESEQKMIKSSRN |
| A0A6A3CWS2 | 116-191 | None |
| A0A0B2PMH8 | 46-133 | None |
| A0A7J0G224 | 65-145 | None |
| A0A834LY45 | 5-79 | None |
| A0A7G2E2D3 | 111-198 | None |
| A0A6J1KUG3 | 127-196 | None |
| A0A6P6WJY0 | 35-105 | None |
| A0A6A6KCZ7 | 74-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.