DPCstruct | MC50806
Metacluster Properties and Pfam Annotations
| Number of structural domains | 389 |
|---|---|
| Mean domain length (aa) | 118 ± 20 aa |
| Standard deviation of domain lengths | 19.75 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 19.79 |
| Pfam Score | 99.40 |
| Assigned Pfam label(s) | PF02508- PF04205 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J4VXD4 | 16-117 | PMYTASAEEAAYRVVEVEEMGKHGPIRLAVTIYDSSYVRHVEVLDMREVKGNGIKKREFLDQFNGKSANDPLRIGRDIDAVTGATIS… |
| A0A7X7WYG1 | 33-161 | EIVKKTYPSATKIVKINDIWNKAVDKRGKVLGYVFNSSEYGKDIRGFRGPVPILIVTDKNQKIRKVTAFNNNETPKYLSKVAAEGLF… |
| H3NK29 | 186-339 | None |
| A0A848VCP7 | 44-174 | None |
| A0A3C0BK89 | 217-348 | None |
| A0A7X6DSQ7 | 355-485 | None |
| A0A7K0P042 | 146-262 | None |
| A0A354VJ35 | 76-183 | None |
| M1Z269 | 2-77 | None |
| Q3Z9P1 | 42-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.