DPCstruct | MC50803
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 83 ± 15 aa |
| Standard deviation of domain lengths | 15.27 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 76.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 52.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A015KZW4 | 1-77 | MSAITTKFVTDHKLTNEMSLEELSQYAPEILELLTTGVPKVDKEKRRQARDRLQKGYKFSKEQAYALIPHERIGRRI |
| A0A397J3V9 | 1-87 | MLAVVTKIVEKYNLSSKTDSSELSQYTTEFLKSLTDDRKRNQARKRLQDGFKFSNEQVSVLIPNQRSGKVKIINVIKGSCKMVVTSP |
| A0A2N0PAW6 | 1-87 | None |
| U9T2D6 | 6-89 | None |
| A0A2H5S759 | 447-516 | None |
| A0A2I1EMK8 | 146-214 | None |
| A0A397JI40 | 1-79 | None |
| A0A397JGD8 | 1-69 | None |
| A0A2N0NVU7 | 1-71 | None |
| A0A397VHX2 | 1-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.