DPCstruct | MC50801
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 90 ± 6 aa |
| Standard deviation of domain lengths | 6.22 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 78.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 57.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N1NFN2 | 28-102 | TENKKPSLMKKANLPTNPAHALEQLRVWAQLEEVEDSFAKMFLVSELLWLIWAFGTSTPYKKKQKLVSIIISNLK |
| A0A2Z6SD71 | 1-86 | MKKVNLPTNPAHVLEQLQVWAQLEKAENSFAKMFSVSELSWIIWAFGISTPYKRKQNIVPIIISSLKNSTPFTEEALLKRRNIFVE |
| A0A015K5M4 | 720-808 | None |
| U9TMS3 | 145-228 | None |
| A0A2N1M1A6 | 1-94 | None |
| A0A2N0RGV7 | 617-712 | None |
| U9T2C7 | 449-537 | None |
| A0A2N0QQH2 | 116-211 | None |
| A0A2N1M915 | 213-307 | None |
| A0A2N0NFS7 | 115-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.