DPCstruct | MC5080
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 285 ± 46 aa |
| Standard deviation of domain lengths | 46.10 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 68.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 27.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF21647 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7N1Z4 | 316-506 | RKWTDRSTLFDGVTVDLARLGKEALRRRTEAMEEASVTESIIMNLRRFSDLCSSSKAEHPLVTIRRFLALYELITESLALVESLVAN… |
| A0A7J9JN86 | 2-247 | QRRILASKAAAEALEEAIATESVVRNLSMFSELSSKSKAGNPLPTIDKFLSIYNDVVKYTGIAETVATRHNSNTDNASKSSSLWVEV… |
| A0A6S7MYL5 | 25-215 | None |
| A0A453RPL7 | 7-342 | None |
| A0A5N5F0M5 | 1-207 | None |
| A0A5J5B3B7 | 204-528 | None |
| A0A067L0B7 | 1-283 | None |
| A0A6V7PNJ8 | 276-581 | None |
| A0A4Y7LDF0 | 780-1077 | None |
| A0A0D3GSZ4 | 53-342 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.