DPCstruct | MC508
Metacluster Properties and Pfam Annotations
| Number of structural domains | 152 |
|---|---|
| Mean domain length (aa) | 127 ± 24 aa |
| Standard deviation of domain lengths | 23.58 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 86.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 20.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07007 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0W0XWH1 | 12-126 | LILLLLASSVFAVDPASLKACYDKAATTLAIHECANQEYAYYDKILNNTYRSLSALLSKENKAALISAQKAWLDFRAKECKFTGLQH… |
| A0A430DI33 | 2-99 | EACLNSGDAAKGVSVAMGACVRDELAVQDARLNAAYKSAMAKRGPAERATLRDEERAWIKRRDVECEEQRTGGTIDMVEVPMCLLHE… |
| A0A7H1N3B8 | 13-127 | None |
| A0A2A4QRM3 | 8-134 | None |
| A0A179BRB5 | 6-104 | None |
| A0A6M1VS67 | 135-284 | None |
| A0A5E4ZLE7 | 23-161 | None |
| I2B6W6 | 132-261 | None |
| A0A7Y6ZUX7 | 6-141 | None |
| A0A1I4NTT7 | 6-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.