DPCstruct | MC50799
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 85 ± 4 aa |
| Standard deviation of domain lengths | 3.72 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 87.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 65.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0194 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z6RQZ0 | 325-410 | LSKEEYWAEMVNITMGVMKKLRDQVNAYLRIKNGISYLKMVYKEVLFPVCFTGKKKYFGVPHKGIVNFRLDDLFRKEIDTVKQGQS |
| A0A2N1MC72 | 1-84 | MVKISMEAIERLYDEVNNFLRNDNGSSFLKMAYEEVLFLVVFTGKKKYYSIPHTRKPNFNNKFFIRGVETVKRRQSSIFHEIGK |
| A0A397TYB0 | 400-475 | None |
| U9UPT8 | 176-261 | None |
| A0A2I1FF19 | 378-464 | None |
| A0A372QC68 | 1-85 | None |
| A0A372Q1I0 | 50-125 | None |
| A0A2N0NRE9 | 245-331 | None |
| A0A397GHG4 | 150-237 | None |
| A0A2N1M2N8 | 1-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.