DPCstruct | MC5079
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 158 ± 28 aa |
| Standard deviation of domain lengths | 28.18 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 68.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 64.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J9JFX6 | 19-159 | PASNAAVSQPKGFIDLLPEVALQGVSWHQHKHILAFISGSNQVTVRDYEDSAGKEPCILTSESQRDVKVLEWRPNGGKGGICIWAAS… |
| A0A251SKZ2 | 62-179 | AAVCWHQKKDILAFVSARNQVTVGDYGEGKDPCILINDLQREVKLVQWRPNAGKTLSVACKGGICIWTASYPGNTACLRPGLTSRGT… |
| A0A444XAE8 | 58-246 | None |
| A0A7J9H540 | 6-122 | None |
| A0A6P4BS60 | 60-245 | None |
| A0A835S5Q8 | 337-523 | None |
| A0A164WMX4 | 346-519 | None |
| A0A7J7GBV3 | 23-167 | None |
| A0A0D2R494 | 86-219 | None |
| A0A287R0Z0 | 107-292 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.