DPCstruct | MC50789
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 401 ± 70 aa |
| Standard deviation of domain lengths | 70.18 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 78.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 15.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A838VH46 | 32-394 | FTSVWGCLHGVTPDNSSRQSLARVRESIDRHIWVARRGLGQIGNGAINFHSLLNCQLNKFKANVSMLQNAGMSIEHDRVHISETALN… |
| A0A397IG23 | 530-978 | SDPIEKSQDFGNVDEAWKDVDLVAYTSTLKIGVSCTNPKFERAFCFFKSYIETNAGTNQMLFRMRCIKEYTCHIEQRSSNLPITEEG… |
| B8IMA6 | 4-415 | None |
| K9V5K9 | 568-994 | None |
| A0A7U0HXB7 | 27-385 | None |
| A0A7X6CAR2 | 416-943 | None |
| A0A397JRJ2 | 208-628 | None |
| A0A7U9KE43 | 526-952 | None |
| A0A7W8K9M7 | 12-336 | None |
| A0A2D6PNU1 | 707-1130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.