DPCstruct | MC50782
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 99 ± 11 aa |
| Standard deviation of domain lengths | 11.06 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G0NY65 | 36-127 | QSMEEKARHQEYPTREEADLIPKYLFDDPIFIIHMCHVCRALSRTLPAFHLDDEFQKIELKLCRICRATYNCQRRIKYFKHDLLCIK… |
| A0A2G5TAU0 | 1-105 | MDAHKNYLIEKSKKVTMPTEKDAELTAKYMFTNDTFILDMCLNCVKKNRKSEIVNVDDEHQSFNVTLCRICRSNFNAQRTRRFFKYE… |
| E3ND25 | 79-164 | None |
| A0A6A5GQ62 | 24-136 | None |
| Q9XWX1 | 1-109 | None |
| A0A2P4V023 | 15-122 | None |
| G0NCD2 | 26-106 | None |
| E3MD45 | 68-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.