DPCstruct | MC5078
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 88 ± 13 aa |
| Standard deviation of domain lengths | 12.63 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 83.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00421 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J9JCX0 | 14-103 | CLSDFYGPTGLKASQVQAFTFLVRDQRLEANVGFAQGPTGLGKYLMHSLTREVIFRREAMRFWDLRARWLEPLRGPNGLDLNMLKKD… |
| A0A838WFD8 | 136-238 | IASVMVWYNNTAYPSEFFGPTGPEASQAQALTFLIRDQRLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRG… |
| A0A1Y3BZQ8 | 71-164 | None |
| A0A650G361 | 293-396 | None |
| A0A287I632 | 136-206 | None |
| A0A3P6DE01 | 56-123 | None |
| A0A2U1PKL1 | 18-92 | None |
| A0A7J6DTD7 | 200-270 | None |
| K0RJ67 | 234-332 | None |
| A0A2N9H999 | 490-588 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.