DPCstruct | MC50778
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 64 ± 4 aa |
| Standard deviation of domain lengths | 4.25 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 74.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0199 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A251NZX9 | 53-116 | QSASNVRATYHIYNPEKINWDLKAASAYCSTWDANKPLEWRRKFGWTAFCGPVGPRGQASCGKC |
| A0A6A1UR83 | 109-170 | GCSASNIRATYHFYNPEQNGWNLNAVSAYCSTWDAKKPLAWRSKYGWTAFCGPVGPRGQAAC |
| A0A0D2ZRF5 | 168-239 | None |
| A0A2N9G5M3 | 313-377 | None |
| A0A6J5VD55 | 21-84 | None |
| A0A4S4DYW5 | 179-240 | None |
| B8BLD9 | 19-83 | None |
| A0A5J9UPM9 | 97-155 | None |
| A0A0E0F773 | 282-340 | None |
| A0A287V7Q7 | 130-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.