DPCstruct | MC50774
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 72 ± 4 aa |
| Standard deviation of domain lengths | 3.77 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 75.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 74.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07798 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J0EU38 | 61-127 | RQISQLAKSNGKRVFLVDTLALVRSLEAQGLPSKQAEAITAAITEVLNDSLENVAHSFVSKAEMQKI |
| A0A2N9EQX1 | 56-127 | RQLHCRHISQIVQSNGKRLFLVDTLALVRRLEGQGVPSKQAEAITAAITEVLNDSVENVSQSFVSMAEMQKI |
| A0A2Z6M354 | 42-115 | None |
| A9SJE9 | 2-70 | None |
| A0A7J0F732 | 1-74 | None |
| A0A061DFG3 | 103-179 | None |
| A0A072UDP5 | 29-107 | None |
| W9S0S0 | 25-98 | None |
| A0A5D2M5L7 | 2-68 | None |
| A0A816RSD0 | 142-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.