DPCstruct | MC5077
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 66 ± 6 aa |
| Standard deviation of domain lengths | 5.65 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 29.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F7YQL1 | 23-85 | MARYYVNKNQQANGDHEVHKQGCSYMPLEHNRTYLGEFASCGPAVTAAKKTYSKANGCYYCSE |
| A0A2U2PC10 | 1-63 | MSFYYVNNNRQYDGAYEVHKEGCCFMPMSRTFLGYFDNVEDAVKEARRYHGHCRTCIYCSTEY |
| A0A542AW01 | 21-83 | None |
| G8QUB4 | 2-64 | None |
| A0A6L7VUP5 | 1-78 | None |
| A0A1M6DIK7 | 2-68 | None |
| J3DJH0 | 1-71 | None |
| A0A427UR45 | 2-71 | None |
| A0A7C6GB32 | 1-71 | None |
| A0A1T5I088 | 37-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.