DPCstruct | MC50764
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 158 ± 16 aa |
| Standard deviation of domain lengths | 16.13 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 43.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05675 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T0VJN9 | 10-154 | LKDFWDFGLKQFRSAIFGITIILSLIVTTFIKIPHLARYDTLLICVLVIQVILLVSKYERVYDLIPIMVFHILGMILEIFKVRHGSW… |
| A0A7Y2IWR4 | 12-185 | FVMFVLKQGWACLFGGLLLIAILVTRAIWQPDWPIQRYDALFLFAILTQAVFLWAKLETWSEARVILLFHLTGTAMELFKVSAGSWS… |
| A0A7Y7HSF7 | 13-178 | None |
| A0A521H242 | 27-203 | None |
| A0A559KGG4 | 2-148 | None |
| A0A2H0BDZ3 | 1-163 | None |
| A0A1C0SUH5 | 2-128 | None |
| A5P7F6 | 28-173 | None |
| A0A0N1HCH2 | 41-194 | None |
| A0A6I2H9P4 | 10-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.