DPCstruct | MC50760
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 154 ± 13 aa |
| Standard deviation of domain lengths | 12.84 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 24.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V9IAM0 | 2-140 | GSSVNVHCQTAGETFTDAGADLGYVAFGSDGVPETKTTIKWEQCRALASFTRSGGIRPSRDEMIAVHVLTHESMHISGIGSEVASEC… |
| A0A535CS00 | 223-383 | LPTVRGEAAASHIDPALGSVASKLVGRTVEVRCWSRSDWARIRRARGDSAIGFAEMRGSRIDLAPLVCRPLMALEYHHDQPLLGSER… |
| A0A7V9P4X1 | 25-192 | None |
| A0A7Y5XXD8 | 86-253 | None |
| A0A7W0TEK2 | 175-324 | None |
| A0A538DMP4 | 107-284 | None |
| A0A7W0ZAK8 | 2-128 | None |
| A0A7Y6CTX4 | 194-354 | None |
| A0A538AKX2 | 175-347 | None |
| A0A5C7J4C3 | 68-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.