DPCstruct | MC5076
Metacluster Properties and Pfam Annotations
| Number of structural domains | 82 |
|---|---|
| Mean domain length (aa) | 423 ± 87 aa |
| Standard deviation of domain lengths | 86.98 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 88.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 25.46 |
| Pfam Score | 96.43 |
| Assigned Pfam label(s) | PF19278- PF02538- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A448UPH6 | 34-521 | LEFKERDPIGYEKMFSKLRGGIVHARETAKRIAASPIVEQEGELCFTLYNAVGDSVLTSTGIIIHVGTMGSAIKYMVENNWEDNPGI… |
| V9VXD6 | 8-438 | LSPARLQVMWNRLLAVVEEQGQTLIRAAFSPIVRECGDISAGIFDAEGRMLAQAVTGTPGHINTMAEAVLHLRERFPVETMKPGDIF… |
| A0A537TZL6 | 13-414 | None |
| E7F6Z6 | 740-1266 | None |
| A0A7C1BLX2 | 4-430 | None |
| A0A7W0N1A0 | 1-277 | None |
| A0A538A926 | 1-381 | None |
| B8IKP0 | 12-445 | None |
| A0A849WU36 | 8-392 | None |
| A0A7X3RVC0 | 9-478 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.