DPCstruct | MC50758
Metacluster Properties and Pfam Annotations
| Number of structural domains | 426 |
|---|---|
| Mean domain length (aa) | 282 ± 66 aa |
| Standard deviation of domain lengths | 66.23 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 87.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 19.76 |
| Pfam Score | 96.97 |
| Assigned Pfam label(s) | CL0323- CL0322- CL0431- PF02620- CL0046 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B1MTX2 | 2-129 | RGRLMQALPSGGVMVSVQAAEADVLPLLAGREAQVSLAAVNGPHSTVISGAETTVMEIAGQFEAHGVKTKRLRVSHAFHSPLMEPML… |
| A0A246RJ50 | 24-320 | SRLRRWLTAPATAPPAGTDDSVVAGICVHLIQLCDLQPRRAALDTVTAAIGHSIGLQAAIVAGLRPKRPDAFLALAETSLRLVALSL… |
| I1CLV2 | 33-353 | None |
| H6SS55 | 30-341 | None |
| A0A2V1DDT1 | 112-447 | None |
| A0A2V1D3K2 | 13-296 | None |
| A0A0G4HAB8 | 315-645 | None |
| A0A1L9VMG8 | 338-612 | None |
| A0A067BW59 | 90-409 | None |
| A0A2N9IPA8 | 883-1158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.