DPCstruct | MC5075
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 213 ± 28 aa |
| Standard deviation of domain lengths | 28.23 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 76.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 23.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820ZVJ6 | 1-212 | MIDNIGESIKMAKIFCFASGQTLTIDDDKIGKIPYLAALVSSADCFESVYDEHGYYKLDLHIEYKYFSFILESISFHSVRQLFTHLP… |
| A0A0G4PFW5 | 17-212 | TVQILIGDIEYAIDMTKMPYFDSYLSFQRSSGQDSTQLPTHDEIPFFRVIDKGINDGFRHFFRCMPTRLSDYRLLCETLEFLCVDVL… |
| C4JNT5 | 378-610 | None |
| A0A819SV66 | 1-203 | None |
| A0A820TEJ3 | 4-249 | None |
| A0A5N5PV47 | 5-242 | None |
| A0A5N5Q1P1 | 1-266 | None |
| A0A2P4ZB96 | 867-1063 | None |
| L7IZE3 | 361-582 | None |
| A0A0C3GQZ5 | 2-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.