DPCstruct | MC5074
Metacluster Properties and Pfam Annotations
| Number of structural domains | 66 |
|---|---|
| Mean domain length (aa) | 171 ± 36 aa |
| Standard deviation of domain lengths | 35.62 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 85.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 22.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11911 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G4PBF5 | 41-252 | EDDIDVMAGMKSEAKVIKETFSLAGVPKEALYLGMAGVVPYLATSMQTVFLSYEINRAAALGDGLIFSGQSAELMLHMLEPIQIGYG… |
| A0A2E6KSL4 | 1-129 | MKKIHLILGYGGLIPFFGLALLHYLNFENADSFLIAYAALIFSFLGGLLWKSTLYNDLPAHVIYISVTVMLWAWVWLIFNQLNWFFI… |
| A0A3M0CFF0 | 17-167 | None |
| A0A251ZXN4 | 4-155 | None |
| A0A1A8ZYR1 | 171-352 | None |
| A0A6C2D105 | 9-157 | None |
| A0A6A6AEA8 | 3-152 | None |
| A0A258IWB3 | 20-160 | None |
| A0A7S3I9I1 | 8-193 | None |
| A0A4T0JES7 | 77-270 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.