DPCstruct | MC50736
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 181 ± 28 aa |
| Standard deviation of domain lengths | 28.34 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 68.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 28.29 |
| Pfam Score | 98.28 |
| Assigned Pfam label(s) | PF00429- CL0148 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7F8K0F3 | 4-124 | VAGISLASPLVAAAIGGGALTHSVSTSRDLEQKLQLAIEASATSITSLQRQITSVARVALQNRRALDLLTADKGGTCLFLQEECCYY… |
| A0A3M0LGA9 | 2-173 | WVCQQIGITPCVYLSKLNNLADFCVQVLIVPRVLYHQEEEMYRFLEETILLRKREVMTGITIAMLLGLGATGTATGVSALVTQHQRL… |
| A0A7J8BEV8 | 1-168 | None |
| A0A5F8A015 | 38-208 | None |
| G3HLH2 | 49-219 | None |
| A0A811XZI1 | 1-157 | None |
| A0A670JPB9 | 245-421 | None |
| A0A667Y4X6 | 326-525 | None |
| A0A6P8T2M0 | 70-265 | None |
| A0A4W5L4Z6 | 89-285 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.