DPCstruct | MC50732
Metacluster Properties and Pfam Annotations
| Number of structural domains | 165 |
|---|---|
| Mean domain length (aa) | 145 ± 20 aa |
| Standard deviation of domain lengths | 19.98 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 12.73 |
| Pfam Score | 64.44 |
| Assigned Pfam label(s) | PF09406- PF10020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T5IPZ6 | 21-161 | LKFEDGSWTVKKYLPFIKQMIEVSIFTDDNPDNKPSSRQLEVFGELEKIALIIDDLNNYARKYLMQIEELRDLEEENIYIDASKIDH… |
| A0A0F5ZUH4 | 4-93 | LESLLIIYPQLQITYGYSDSEKAEYMPDVLVPNDFNTLISLHSVNVHPLCKDGVPYIGFEFGCKWDEEHGLGVLMHGSRVVEIGGAD… |
| A0A5R8QAJ5 | 1-138 | None |
| A0A7X2USB4 | 8-119 | None |
| A0A833MZG4 | 5-125 | None |
| A0A2E9VRH6 | 5-131 | None |
| A0A3D9AKU5 | 210-373 | None |
| A0A1M5M8K2 | 132-312 | None |
| A0A517PVB7 | 227-377 | None |
| A0A1M5RLW8 | 4-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.