DPCstruct | MC5073
Metacluster Properties and Pfam Annotations
| Number of structural domains | 70 |
|---|---|
| Mean domain length (aa) | 141 ± 21 aa |
| Standard deviation of domain lengths | 20.67 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 27.55 |
| Pfam Score | 91.80 |
| Assigned Pfam label(s) | PF21666- CL0029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T9Y3Y7 | 30-148 | FEQKILKVLTEIKNKPNWNKKIKNTEIREKWIKELQPHFEEKTINYAIDETLYYSDIFTGSLVPGAVDCTYIDDDCVPEELLNELKL… |
| A0A0G4NWN1 | 102-255 | GPIPLNYELPPKARFAHGLVEYRNLPRLTKREMAMLRMMQHITENPGWDQALLGPDETQLTQWRQEAVATEEFLISAPAWDWCIAEL… |
| A0A6P8BKW3 | 13-197 | None |
| A0A6G1MJI3 | 2-162 | None |
| A0A6G0XMX7 | 9-126 | None |
| A0A4Z0YM94 | 43-193 | None |
| A0A1V6RVH7 | 102-231 | None |
| A0A1V6RER9 | 2-123 | None |
| A0A2K0VWD3 | 17-162 | None |
| K9GCK3 | 2-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.