DPCstruct | MC50728
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 97 ± 12 aa |
| Standard deviation of domain lengths | 11.54 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 46.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0098 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K4AKW3 | 2-93 | PDVIDEIRKSEDILIVVGAEKVPAEVYQLADWNVAVGNQPHSEVAALAVFLDRLFLGRELFREFEGGLKIVPSSRGKEVIYPEFSSK… |
| A0A7J3C5W9 | 71-166 | FKGKKVHLTMYGIPLEKKIKEIREIDDIMVIVGSEKVPREVYELADYNIAVKNQPHSEVSALSLFLYRLGRQKEFYGQLKIIPTERG… |
| A0A7J3JW94 | 1-69 | None |
| A0A849Q6H3 | 56-166 | None |
| A0A7K4F6U0 | 4-90 | None |
| A0A2R6DWB2 | 40-139 | None |
| A0A7C5VV46 | 15-120 | None |
| A0A832ZW33 | 11-109 | None |
| A0A2R6DTR9 | 38-140 | None |
| A0A2R6BS19 | 100-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.