DPCstruct | MC5072
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 255 ± 45 aa |
| Standard deviation of domain lengths | 44.61 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 77.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 19.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7DJ21 | 23-300 | WSDIVALLADIAQNPGAYGVLPQNVANLRLIHADITRLRRPDGPSYLVPPPPQNIDRKRHPKWPSALSRFRLTKSTYDGVEYWALPD… |
| A0A0G4NTX5 | 34-305 | RTVVSELKRLRTDILDLSENGNRYQSEPFYPQAVSRVANPAAANEDEPYFLLDELTYGGVLYWSSFDLLGRFISLTGPAPRGATRDN… |
| A0A0L1JI49 | 1-223 | None |
| A0A1V6SA34 | 15-290 | None |
| A0A6G1J612 | 8-255 | None |
| A0A6A7AKP2 | 9-244 | None |
| A0A0N0RTK0 | 4-249 | None |
| A0A1L9PVM9 | 32-312 | None |
| A0A0H2RU73 | 27-281 | None |
| A0A6A4GNJ3 | 16-291 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.