DPCstruct | MC50716
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 113 ± 14 aa |
| Standard deviation of domain lengths | 14.45 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 30.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0108 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W4UK13 | 207-324 | IPSDEREAEVTRWLAREAVETGVGRHAGTVTEIFTPTGKTQVVRGKDLSAVRWVVGTGGALTRVPGGADILRRICTGAGAQLLPSPE… |
| A0A3E0KEV5 | 9-132 | CVGLAVRRHAGRLRVVESPAGRRRVQRGKDLRPVRAVIGTGGVIRHARAPGFILEAALEGCGGETGRVEGAEAGSGGGDEVLLLPRQ… |
| A0A847XFX3 | 12-120 | None |
| A0A4Q7WCU5 | 149-277 | None |
| A0A265QB47 | 143-256 | None |
| A0A7C6IR74 | 1-96 | None |
| A0A353NR27 | 18-124 | None |
| A0A7X8X5K4 | 6-109 | None |
| A0A7X8Z5G4 | 2-105 | None |
| A0A7X6TL24 | 1-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.