DPCstruct | MC5071
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 282 ± 38 aa |
| Standard deviation of domain lengths | 37.87 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 21.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15014 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2FSF6 | 7-272 | RPDATFEVFAAEHYLSAGGKAAEVLTLTHMGLWLRESTASRSERVSIVMEYAAIQFGAKALFPDIGPGGELVWDNWATVAWYPEANR… |
| H2Q7N7 | 96-394 | IPSRRHWPVPYKRFDFRPKPDPYCQAKYTFCPTGSPIPVMEGDDDIEVFRLQAPVWEFKYGDLLEHLKIMHDAIGFRSTLTGKNYTM… |
| A0A812LVP8 | 123-421 | None |
| R1BRG1 | 32-339 | None |
| A0A482UPY1 | 19-251 | None |
| A0A2P6NCZ8 | 525-798 | None |
| A0A1Q9C9U7 | 17-351 | None |
| A0A482SEF6 | 1-224 | None |
| R1DHU2 | 3-295 | None |
| A0A812HBE8 | 52-373 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.