DPCstruct | MC50705
Metacluster Properties and Pfam Annotations
| Number of structural domains | 139 |
|---|---|
| Mean domain length (aa) | 270 ± 70 aa |
| Standard deviation of domain lengths | 70.46 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 82.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 22.61 |
| Pfam Score | 98.54 |
| Assigned Pfam label(s) | CL0533- PF09753- CL0072- CL0479 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0V0Y4S0 | 2-251 | YKVPAQNTGKALIAGAAGAWQNTAAVTGANGHSFAKALEHVIAANAANKFIAYNNIPPDIPKVETKSNSKGVLMMNPGGADEASWIV… |
| A0A0K0D5B0 | 3-228 | GVTFFNGEGGVWLIHSVPKFPPPNFYQYPRSGHHYGQTMLCLSLPYSQLENIATQLYYNKPDIYSSQLPTTMAADYPVLAQVIAGKY… |
| R7T876 | 4-197 | None |
| A0A3Q0JF08 | 351-580 | None |
| A0A1D2NGS1 | 11-492 | None |
| F4Q285 | 17-383 | None |
| A0A354T8T2 | 452-854 | None |
| A0A0V0ZUW0 | 376-646 | None |
| A0A6A4VRV3 | 233-566 | None |
| A0A418B7U6 | 8-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.