DPCstruct | MC5070
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 148 ± 26 aa |
| Standard deviation of domain lengths | 25.95 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 89.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 31.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2BRB5 | 21-166 | FMPYMHECLVTRDLKKAAWLQYNATQAGKFGPLTAEFDGSYCFVEGHCTSEFSAETSLEEAERACDKRFGREVWTGYGSLRSPEGDK… |
| A0A7S2F557 | 21-164 | CTVKYLPAWYQCLKGDPIKGAHMVYDLQAPSHPRPGHPGTVRSLDAGYCFAAGHCNNTRVTANTTLQEAEAMCNDIYGSDWKGLNFN… |
| A0A7S2GPM2 | 2-116 | None |
| A0A7S2CPC9 | 25-163 | None |
| A0A7S2BRF7 | 25-178 | None |
| A0A7S2AF34 | 17-129 | None |
| A0A7S2NHG0 | 85-252 | None |
| A0A7S2NB19 | 17-131 | None |
| A0A7S2MUL4 | 74-227 | None |
| A0A812SWQ7 | 29-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.