DPCstruct | MC507
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 137 ± 17 aa |
| Standard deviation of domain lengths | 17.46 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 24.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y9NFC8 | 1-101 | MTALIDWTALQGALLLFTVTAAEVDAVRADVIVLDGDKEGEVYTDTLIFPKVLQTQVKPSIGSMVLGRLGQGQKKPGQSPPWVLLPA… |
| A0A449H9I1 | 1-122 | MHDLFDNPGSATGLDLNEIEGRLLLIKPLSQEIGINTSLGEKDAVRADVTVLDGPDAPIEHADVLIFPKVLQGQVKANIGTGRFNLG… |
| A0A544ZJL9 | 3-124 | None |
| A0A5P2CQM0 | 5-136 | None |
| A0A8B3D8H0 | 17-165 | None |
| A0A2S9PY27 | 3-133 | None |
| A0A117IA26 | 59-220 | None |
| A0A844LKZ3 | 2-153 | None |
| A0A1Y0CEP0 | 3-139 | None |
| A0A1H4UGM8 | 87-254 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.