DPCstruct | MC50697
Metacluster Properties and Pfam Annotations
| Number of structural domains | 144 |
|---|---|
| Mean domain length (aa) | 195 ± 42 aa |
| Standard deviation of domain lengths | 41.65 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 83.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 15.51 |
| Pfam Score | 88.24 |
| Assigned Pfam label(s) | CL0560- PF11086- CL0027- CL0116 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4N1Y1 | 430-612 | LRPLKDRATGIEFAPKLDDMYLLGVGVRKKAIINVYSVGAYSSYEAKRSLSSLSAKSDRKAALSALRSAAKTAPTTSFLLQMAFKAG… |
| A0A7S2PUF1 | 137-322 | SQLNPIQEYATSVTFAPKLEDGLYLAGAGVRKRSIVKVYAVAMYSSPLVLQALSKESTSVMRNAARSFSPASPSTTFVLEMTYSAGA… |
| A0A547ERL8 | 10-157 | None |
| A0A3D3GRS6 | 51-256 | None |
| A0A7S0LZD9 | 7-130 | None |
| A0A6A6L6I9 | 196-386 | None |
| M1UPD2 | 141-351 | None |
| A0A5D2JYJ4 | 1-138 | None |
| K0TK93 | 126-313 | None |
| A0A1E7FDE4 | 52-292 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.