DPCstruct | MC50696
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 162 ± 19 aa |
| Standard deviation of domain lengths | 18.98 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 20.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2PLI9 | 9-192 | TWKEWSYATDENGQSYYWEKWERITGDELGQGLRLAMRKKKQVPSREGCDDAILVAVGDHFNYIVGRQFLDLHTRYGDVSSNTVELV… |
| A0A1Z5JH68 | 142-310 | CCASAPMGADGSVDIRETGHDASYAEGWHRLPKTSNGPYMALELMSEERKGYWVRAGNHFAYAVGRPLHNRLDEYNVSSLQDLSKMS… |
| A0A1Q9EAP7 | 336-490 | None |
| A0A7S4RCP1 | 244-377 | None |
| A0A538Q5E7 | 47-187 | None |
| A0A7S4MZP5 | 119-282 | None |
| B7FZX3 | 195-377 | None |
| A0A812RIR6 | 29-181 | None |
| A0A1E7FQP1 | 3-165 | None |
| A0A7S0ZB89 | 236-391 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.