DPCstruct | MC50693
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 138 ± 23 aa |
| Standard deviation of domain lengths | 23.02 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 86.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 35.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04891 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A426FKR7 | 16-166 | PDDVAYLLQRAVSGVLRAAQNGDLPLFAWTLGLPQEELLEVLARLFPEVEPVEPLRDVQYQQLLALKPRDFQSMLRLLEQSRNPQLP… |
| A0A2W7HJ72 | 23-152 | FVVGLRDASMTAATATVAIDDANHAAFVAAMRGLLTGFASSDVDRDDMVCVATIVAYACLRPDHLWRDLGLCGRDDVTAMLERFFPA… |
| A0A0C5V330 | 37-187 | None |
| A0A811BXW6 | 14-146 | None |
| A0A2R5EIA8 | 11-130 | None |
| A0A560BC09 | 20-198 | None |
| A0A2A6M7S2 | 32-171 | None |
| A0A4Q9VSZ4 | 96-199 | None |
| A0A257XG50 | 106-255 | None |
| A0A347U4I7 | 4-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.