DPCstruct | MC50680
Metacluster Properties and Pfam Annotations
| Number of structural domains | 81 |
|---|---|
| Mean domain length (aa) | 160 ± 27 aa |
| Standard deviation of domain lengths | 27.31 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 90.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 24.74 |
| Pfam Score | 79.85 |
| Assigned Pfam label(s) | CL0344- PF04422- PF04432 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M6JQ54 | 1-169 | MIKISDKTQCCGCSSCAETCPVNCIKMVEDNEGFLFPQVDTSACINCGACEKVCPIIQADCVDAGEIAGVFEQPKTIGGWIKDDSIR… |
| B3T2G1 | 4-229 | SINQLSDIVDNGLCIGCGLCQSIAGKDKIEVSMTPKGRLEPKEISKITPEIFKKIINVCPGVIVEGLPKEQVPSNAEHDIVWGYYLS… |
| W0ERN0 | 1-108 | None |
| A0A7X3MES7 | 10-163 | None |
| A0A3R6QY04 | 22-173 | None |
| A0A2R6CBL3 | 5-186 | None |
| A0A257MSE1 | 128-339 | None |
| A0A415YAT3 | 1-98 | None |
| N0BKY2 | 189-374 | None |
| A0A059AV62 | 104-260 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.