DPCstruct | MC5068
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 102 ± 14 aa |
| Standard deviation of domain lengths | 14.26 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2CD99 | 10-112 | ESCVLKLKDQPTTVRVNLGKNDYEDVWVDPHRGPFLATPDGQPLNMIFHPNPGGGHTGHGRGAYMKFWPDMGRTEKEVHLHLVAKRN… |
| A0A7S2D8J4 | 13-95 | AEVHTVLVDVGGGEQETVVVHPYYGPMVRAADGKYESMKETTFIHRASRKLWYNMSSTEKEVTLRIVAKKNRQLANLGTKLPL |
| A0A7S1SGK6 | 111-215 | None |
| A0A7S1S4W2 | 24-137 | None |
| A0A7S1S013 | 52-160 | None |
| A0A7S4QC18 | 19-123 | None |
| A0A6T1FIS2 | 7-110 | None |
| A0A7S2IGT4 | 30-139 | None |
| A0A7S2C2F5 | 10-99 | None |
| A0A7S4RCV7 | 20-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.