DPCstruct | MC50679
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 144 ± 28 aa |
| Standard deviation of domain lengths | 28.20 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 69.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 31.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00140- PF03979 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q7HWB5 | 11-181 | QIEPAAPREQRETVVRLLAKGREQGYLAQEDLVRALPDPEPGEMDELLQTVDDLGIELLEEHGPDWTALKAEEAEAEELSREDLEVA… |
| A0A162TU70 | 11-167 | EQQARIKELIAQGKEQGYLTYAEINDHLPEDIIDPEQIESIIAMISEMGIKVSDEAPDMDSLLLTNDSIGSDDDAVDEAAAVLVNID… |
| A0A6L5K2U6 | 7-118 | None |
| A0A381I8W8 | 10-179 | None |
| A0A381G2I9 | 8-139 | None |
| A0A6P5UL51 | 21-152 | None |
| A0A1V1P8N7 | 2-108 | None |
| A0A2X1RPW2 | 1-138 | None |
| A0A529PJX3 | 1-201 | None |
| A0A376Y2E9 | 1-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.