DPCstruct | MC50677
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 100 ± 4 aa |
| Standard deviation of domain lengths | 4.32 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 90.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 37.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W7V0A8 | 548-647 | QWGKPVIYLYPEKETDVHVDLKLTTSDLYTTYPRYNNGWDVTAYPDGSLLNKADGTHHKYLFWESVNARTRFDFSKGFCVAGSDTES… |
| A0A1G2B1Y0 | 1-99 | MVECGKPVIYLYPEVAMDVNVQVAPNGGFTVTDPEYPEGGWNVTAQPDSTLTTAGAVYPYLFWEGNGVNYEIPKEGFVVSKAGVLDF… |
| A0A1F4NR97 | 3-97 | None |
| A0A556MQ94 | 134-234 | None |
| A0A7Y3PA97 | 539-635 | None |
| A0A7T9I2M5 | 61-161 | None |
| A0A1M3E3L0 | 103-211 | None |
| A0A2M7VFI8 | 423-519 | None |
| A0A6A4H362 | 1-108 | None |
| A0A2M8F4K9 | 498-591 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.