DPCstruct | MC5067
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 88 ± 9 aa |
| Standard deviation of domain lengths | 9.10 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 71.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 24.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812IE00 | 217-313 | RPPTPKRKRLEPERASCSSGSASSEEGLTPADAEAFLARLDARPTCSSGHPLFSFGPPEPGWWCSSCKRVFTTRRLLWGCRVCDFDV… |
| A0A812J5R4 | 194-277 | QLQAVAFSELSPSRVVEVPTAASTTATASTRFCPSGHAMSVFTAAKDGATCQICGALHAPGSVLMRCDLCGHEACMGCTAKAAD |
| A0A812IX68 | 142-215 | None |
| A0A813GHH8 | 258-355 | None |
| A0A7S0CXY0 | 70-169 | None |
| A0A812YIU3 | 3-85 | None |
| A0A835SUF5 | 78-155 | None |
| A0A6V1SXK6 | 30-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.