DPCstruct | MC50667
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 280 ± 35 aa |
| Standard deviation of domain lengths | 34.91 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 25.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X1YZA5 | 25-297 | GAALSGAATHLARALDQGLLDEAGWDPVTRVLYLPAQHRLLGRKVCRVERCVGTVHNDAPEICHRCFTRLTGMGMSVEDIAAAESLP… |
| A0A3N1L991 | 1-260 | MNTPRPAGAPDHSSLLGLLMASVRVEFRSDVLTFAAEDPVFGGGACTVASCERSARSFGLCQGHHQRWNRQGRPDLETYAATTDSHW… |
| A0A429PG63 | 9-289 | None |
| A0A5B7VB80 | 3-317 | None |
| A0A5M3W4F3 | 1-300 | None |
| A0A2N4A4U0 | 4-289 | None |
| A0A6A0CD47 | 13-322 | None |
| A0A7V3IZP4 | 12-283 | None |
| X7XRJ5 | 5-329 | None |
| A0A1C5DXJ8 | 2-313 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.