DPCstruct | MC50666
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 201 ± 37 aa |
| Standard deviation of domain lengths | 36.58 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 80.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 22.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03771 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N1L7A5 | 5-219 | FGWHTWRNDLGEEFASNPSHQIRAARLTAPYTDWPWQMAAHWDPFAPAAPDWTAFFSWETPREIVVQFHRAVGAMFADHGRLDDREP… |
| A0A3R9WKL6 | 20-209 | DAGFAPVAHWPHHHLDEGPHQLVVTSPDHRIRIGWAGDDYDLWTISAAPHAVSGPQWTAIVNQNTPPELVAALTATLAQDWAAGQDR… |
| A0A6N7KYU7 | 15-170 | None |
| A0A0Q8NGV4 | 30-283 | None |
| A0A4V2TW03 | 10-178 | None |
| A0A7Z0PS20 | 177-384 | None |
| A0A0D4DFH9 | 6-184 | None |
| A0A0D4DXG5 | 21-213 | None |
| A0A1H8A541 | 1-232 | None |
| A0A7X0GUW6 | 25-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.