DPCstruct | MC50665
Metacluster Properties and Pfam Annotations
| Number of structural domains | 98 |
|---|---|
| Mean domain length (aa) | 130 ± 16 aa |
| Standard deviation of domain lengths | 16.10 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 26.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13665 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E1VFL2 | 3-127 | GMAYKGSRTNSSVASDHVEIEERHDDHYHDGTTSATIEGTLNGGSSNVYVNGRQAACNGDPVTETESYSIPSGWYWKSSDGGGTGYV… |
| A0A1Z9KHU7 | 3-127 | CKTQLPSMSLAFPDTCNVMTPAGPVPTPFPNIAMSSLAIPNILNHFITAMPVHNLGTVTPLSSGNEASAPLGGVVSARFIGPQRNLL… |
| A0A1H0S882 | 1-149 | None |
| A0A0C6G1F1 | 744-878 | None |
| A0A0C6FK41 | 1-105 | None |
| A0A0C6FFE9 | 468-600 | None |
| A0A1M7P3W3 | 7-142 | None |
| A0A4R3X4G7 | 11-109 | None |
| A0A017SZW7 | 1-144 | None |
| U2FSB3 | 19-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.