DPCstruct | MC50663
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 66 ± 6 aa |
| Standard deviation of domain lengths | 5.74 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 76.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 37.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0395 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J3PLI2 | 1-67 | MPASRPGGKVNKCGNIVNGDGEVVDRIKEGVPGHLVGKRVDETGAIWNDSGAVISRAEPIPENELES |
| A0A150UYG9 | 475-543 | GHHASWSPPVRILEGYKINRQGMILNEEGDTIGELYEGDIIDCVRQRVNGFGEILNDYGRIVGRARTVS |
| B8MSZ4 | 2-72 | None |
| A0A6M7Z4T4 | 417-482 | None |
| A0A117NT33 | 2-60 | None |
| A0A2D3UXR5 | 206-278 | None |
| J3PK26 | 74-151 | None |
| A0A395NIG5 | 315-373 | None |
| A0A0M8PG46 | 339-407 | None |
| B8M0B4 | 381-441 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.