DPCstruct | MC5066
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 140 ± 18 aa |
| Standard deviation of domain lengths | 17.60 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 20.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V6RZ19 | 1-114 | MATLQADSDLAWPTQLSSGFAQSFGRVRYQDFAGVTVVSLRTDVGGSSIACIYLLLDETQGAYAGGCGSSAVTAETVLVVTDSMPGA… |
| A0A399NP11 | 1-143 | MVLWAASLIVAVTGSSATTWWLLRDPGTAAGVIALGPSKAVLPFESVDGGQVLSGEFYGLTVAKLPKNADVAQLDDDCLSITPVSIY… |
| A0A1P8U6V8 | 130-258 | None |
| A0A7I0EHR0 | 2-113 | None |
| A0A3L7IV63 | 46-180 | None |
| A0A0S9QVM7 | 105-241 | None |
| A0A4Y4BAX2 | 36-195 | None |
| A0A4Y8Q5Z1 | 91-236 | None |
| A0A074U385 | 1-159 | None |
| A0A7W4UH63 | 36-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.