DPCstruct | MC50659
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 150 ± 12 aa |
| Standard deviation of domain lengths | 11.55 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 29.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J3PF71 | 3-160 | EGQPPNVAISNQHEKPDDFSLPEFRALVSVLLGHRIQWQNILVELAIPYVDFRKDETSLVLFQAMYQAGPPSEGSALRQGNHALDDA… |
| A0A1V8S7Q9 | 463-613 | PDGPEPNVVIATQDSCPEDMTLEEYKELATVPLGHHIQWANILLQLAMPGVDFKKPETTLVFLQCIYQAGPPNSSVSRESHDMLLYD… |
| A0A820U798 | 23-174 | None |
| W7MJ48 | 285-434 | None |
| A0A6A4H2U9 | 242-402 | None |
| J3PJA6 | 1-146 | None |
| A0A0C3AR72 | 623-790 | None |
| A0A5N6ZR20 | 7-153 | None |
| A0A1C7MP96 | 371-520 | None |
| A0A2B7YYZ0 | 11-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.