DPCstruct | MC50653
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 93 ± 16 aa |
| Standard deviation of domain lengths | 15.58 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 30.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q2LK65 | 1-93 | MQDNATENNTNFQQTKQIQEKQILEMYYSYGENKQKLDSISKHTDDINLHIITQGYENGEIVDVTLEFQGESFQTSATIQDNQAIII… |
| A0A417HYG0 | 1-88 | DKGITEVYWTYSKNYIRLKKKSRHYIDLNLHIKTHGYMPGECMAILIKRNDSTSIAVGTNQIQIIGRVNNNSEVIIENVFEKYTLNLC |
| N2B3S2 | 509-595 | None |
| A0A809NK18 | 583-672 | None |
| A0A6M1DVD2 | 24-133 | None |
| A0A1A7KHQ4 | 629-740 | None |
| A0A6L6IU12 | 318-398 | None |
| K8AZ03 | 83-176 | None |
| A0A0C2ZCQ7 | 50-126 | None |
| A0A3S8ZP02 | 114-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.